The world's first wiki where authorship really matters (Nature Genetics, 2008). Due credit and reputation for authors. Imagine a global collaborative knowledge base for original thoughts. Search thousands of articles and collaborate with scientists around the globe.
wikigene or wiki gene protein drug chemical gene disease author authorship tracking collaborative publishing evolutionary knowledge reputation system wiki2.0 global collaboration genes proteins drugs chemicals diseases compound
Hoffmann, R. A wiki for the life sciences where authorship matters. Nature Genetics (2008)
 
Gene Review

ABCF1  -  ATP-binding cassette, sub-family F (GCN20)...

Homo sapiens

Synonyms: ABC27, ABC50, ATP-binding cassette 50, ATP-binding cassette sub-family F member 1, EST123147, ...
 
 
Welcome! If you are familiar with the subject of this article, you can contribute to this open access knowledge base by deleting incorrect information, restructuring or completely rewriting any text. Read more.
 

High impact information on ABCF1

  • Unlike the majority of ABC proteins, which are membrane-associated transporters, ABC50 associates with the ribosome and co-sediments in sucrose gradients with the 40 and 60 S ribosomal subunits [1].
  • ABC50 interacts with eukaryotic initiation factor 2 and associates with the ribosome in an ATP-dependent manner [1].
  • The two critical HLA regions for susceptibility to AIP are limited to the HLA-DRB1*0405-DQB1*0401 in the class II and the ABCF1 proximal to C3-2-11, telomeric of HLA-E, in the class I regions [2].
  • In this manuscript, sequence analysis has been employed to analyse two families of twin-NBD proteins, ABCE and ABCF [3].
 

Biological context of ABCF1

 

PMID: 18288386

  • ABCF1 is a target of caspase 8 + 10.
 

PMID: 15013441

  • contains pair of nucleotide binding domains (NBD) with no associated transmembrane domains sequence similarity between.
  • eukaryotic ABCF proteins, which are involved in translation initiation and elongation .
  • prokaryotic ABCF proteins which are implicated in resistance to macrolide inhibitors of protein synthesis .
 

Re: Interacts with Eukaryotic initiation factor 2 (eIF2 ); PMID: 17894550807

  • Regulatory phosphorylation by CK2
  • Ser 109, 140; PO4- not required for binding to eIF2
 

PMID: 9790762

  • 2 ABC transporter family signature motifs,
  • 2 ATP/GTP-binding site A motifs,
  • 3 nuclear localization patterns
  • hypothesized that ABC50 and MHC class I are part of the same chromatin expression domain.
  • TNF-alpha stimulation increases the expression
 

PMID: 17964270

  • Intron 13 contains the microRNA MIRN877
 

PMID: 10931828

  • Interacts with eiF2
  • Associates with ribosome in an ATP-dependent manner
  • 110 kDa size protein
  • no effect on ability of eIF2 to bind GDP
  • markedly enhanced association of methionyl-tRNA
  • associates with Ribosome
  • co-sediments in sucrose gradients with 40S & 60S ribosomal subunits .
  • ATP increases association with ribosome
  • ADP increases association with ribosome? mRNA translation control
 

PMID: 12023305

  • protein kinase GCN2 is activated in amino acid-starved cells on binding of uncharged tRNA to a histidyl-tRNA synthetase (HisRS)-related domain
  • requirement for ribosome binding, dimerization, and association with the GCN1/GCN20 regulatory complex ...
  • suggest that all of these functions facilitate tRNA binding to wild-type GCN2
 

Sequence:

MPKAPKQQPPEPEWIGDGESTSPSDKVVKKGKKDKKIKKTFFEELAVEDKQAGEEEKVLKEKE

QQQQQQQQQQKKKRDTRKGRRKKDVDDDGEEKELMERLKKLSVPTSDEEDEVPAPKPRGGK

KTKGGNVFAALIQDQSEEEEEEEKHPPKPAKPEKNRINKAVSEEQQPALKGKKGKEEKSKGKA

KPQNKFAALDNEEEDKEEEIIKEKEPPKQGKEKAKKAEQMEYERQVASLKAANAAENDFSVS

QAEMSSRQAMLENASDIKLEKFSISAHGKELFVNADLYIVAGRRYGLVGPNGKGKTTLLKHI

ANRALSIPPNIDVLLCEQEVVADETPAVQAVLRADTKRLKLLEEERRLQGQLEQGDDTAAER

LEKVYEELRATGAAAAEAKARRILAGLGFDPEMQNRPTQKFSGGWRMRVSLARALFMEPTL

LMLDEPTNHLDLNAVIWLNNYLQGWRKTLLIVSHDQGFLDDVCTDIIHLDAQRLHYYRGNY

MTFKKMYQQKQKELLKQYEKQEKKLKELKAGGKSTKQAEKQTKEALTRKQQKCRRKNQDE

ESQEAPELLKRPKEYTVRFTFPDPPPLSPPVLGLHGVTFGYQGQKPLFKNLDFGIDMDSRIC

IVGPNGVGKSTLLLLLTGKLTPTHGEMRKNHRLKIGFFNQQYAEQLRMEETPTEYLQRGFNL

PYQDARKCLGRFGLESHAHTIQICKLSGGQKARVVFAELACREPDVLILDEPTNNLDIESIDA

LGEAINEYKGAVIVVSHDARLITETNCQLWVVEEQSVSQIDGDFEDYKREVLEALGEVMVSRPRE

Ref: <http://www.ncbi.nlm.nih.gov/entrez/viewer.fcgi?db=protein&id= 69354671log$=ProtAccnMenu>

References

  1. ABC50 interacts with eukaryotic initiation factor 2 and associates with the ribosome in an ATP-dependent manner. Tyzack, J.K., Wang, X., Belsham, G.J., Proud, C.G. J. Biol. Chem. (2000)
  2. Two critical genes (HLA-DRB1 and ABCF1)in the HLA region are associated with the susceptibility to autoimmune pancreatitis. Ota, M., Katsuyama, Y., Hamano, H., Umemura, T., Kimura, A., Yoshizawa, K., Kiyosawa, K., Fukushima, H., Bahram, S., Inoko, H., Kawa, S. Immunogenetics (2007)
  3. Sequence analysis of twin ATP binding cassette proteins involved in translational control, antibiotic resistance, and ribonuclease L inhibition. Kerr, I.D. Biochem. Biophys. Res. Commun. (2004)
 

Links